PDB entry 1pqw

View 1pqw on RCSB PDB site
Description: putative enoyl reductase domain of polyketide synthase
Deposited on 2003-06-19, released 2003-07-08
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-08, with a file datestamp of 2003-07-08.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: 0.197
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1pqwa_
  • Chain 'B':
    Domains in SCOP 1.65: d1pqwb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pqwA (A:)
    sdlvvpipdtladneaatfgvayltawhslcevgrlspgervlihsatggvgmaavsiak
    migariyttagsdakremlsrlgveyvgdsrsvdfadeileltdgygvdvvlnslageai
    qrgvqilapggrfielgkkdvyadaslglaalaksasfsvvdldlnlklqparyrqllqh
    ilqhvadgklevlpvtaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pqwA (A:)
    neaatfgvayltawhslcevgrlspgervlihsatggvgmaavsiakmigariyttagsd
    akremlsrlgveyvgdsrsvdfadeileltdgygvdvvlnslageaiqrgvqilapggrf
    ielgkkdvyadaslglaalaksasfsvvdldlnlklqparyrqllqhilqhvadgklevl
    pvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pqwB (B:)
    sdlvvpipdtladneaatfgvayltawhslcevgrlspgervlihsatggvgmaavsiak
    migariyttagsdakremlsrlgveyvgdsrsvdfadeileltdgygvdvvlnslageai
    qrgvqilapggrfielgkkdvyadaslglaalaksasfsvvdldlnlklqparyrqllqh
    ilqhvadgklevlpvtaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pqwB (B:)
    atfgvayltawhslcevgrlspgervlihsatggvgmaavsiakmigariyttagsdakr
    emlsrlgveyvgdsrsvdfadeileltdgygvdvvlnslageaiqrgvqilapggrfiel
    gkaslglaalaksasfsvvdldlnlklqparyrqllqhilqhvadgklevlpvta