PDB entry 1pqu

View 1pqu on RCSB PDB site
Description: Crystal Structure of the H277N Mutant of Aspartate Semialdehyde Dehydrogenase from Haemophilus influenzae Bound with NADP, S-methyl cysteine sulfoxide and cacodylate
Class: oxidoreductase
Keywords: Enzyme, L-aspartate semialdehyde, cacodylate, NADP, OXIDOREDUCTASE
Deposited on 2003-06-19, released 2004-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.182
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: HAEMOPHILUS INFLUENZAE [TaxId:71421]
    Gene: ASD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44801 (0-370)
      • engineered (276)
    Domains in SCOPe 2.07: d1pqua1, d1pqua2
  • Chain 'B':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: HAEMOPHILUS INFLUENZAE [TaxId:71421]
    Gene: ASD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44801 (0-370)
      • engineered (276)
    Domains in SCOPe 2.07: d1pqub1, d1pqub2
  • Chain 'C':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: HAEMOPHILUS INFLUENZAE [TaxId:71421]
    Gene: ASD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44801 (0-370)
      • engineered (276)
    Domains in SCOPe 2.07: d1pquc1, d1pquc2
  • Chain 'D':
    Compound: aspartate-semialdehyde dehydrogenase
    Species: HAEMOPHILUS INFLUENZAE [TaxId:71421]
    Gene: ASD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44801 (0-370)
      • engineered (276)
    Domains in SCOPe 2.07: d1pqud1, d1pqud2
  • Heterogens: CAC, NAP, CYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pquA (A:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqagqkapvfggkdagdlksafd
    ieelkkldiivtcqggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhvi
    seglkkgiktfvggnctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqm
    glleqavsselkdpassildierkvtakmradnfptdnfgaalggslipwidkllpetgq
    tkeewkgyaetnkilglsdnpipvdglcvrigalrcnsqaftiklkkdlpleeieqiias
    hnewvkvipndkeitlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaae
    pvrrilkqlva
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pquB (B:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqagqkapvfggkdagdlksafd
    ieelkkldiivtcqggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhvi
    seglkkgiktfvggnctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqm
    glleqavsselkdpassildierkvtakmradnfptdnfgaalggslipwidkllpetgq
    tkeewkgyaetnkilglsdnpipvdglcvrigalrcnsqaftiklkkdlpleeieqiias
    hnewvkvipndkeitlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaae
    pvrrilkqlva
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pquC (C:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqagqkapvfggkdagdlksafd
    ieelkkldiivtcqggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhvi
    seglkkgiktfvggnctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqm
    glleqavsselkdpassildierkvtakmradnfptdnfgaalggslipwidkllpetgq
    tkeewkgyaetnkilglsdnpipvdglcvrigalrcnsqaftiklkkdlpleeieqiias
    hnewvkvipndkeitlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaae
    pvrrilkqlva
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pquC (C:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqlksafdieelkkldiivtcqg
    gdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhviseglkkgiktfvggn
    ctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqmglleqavsselkdpa
    ssildierkvtakmradnfptdnfgaalggslipwidkllpetgqtkeewkgyaetnkil
    glsdnpipvdglcvrigalrcnsqaftiklkkdlpleeieqiiashnewvkvipndkeit
    lreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaaepvrrilkqlva
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pquD (D:)
    mknvgfigwrgmvgsvlmdrmsqendfenlnpvffttsqagqkapvfggkdagdlksafd
    ieelkkldiivtcqggdytnevypklkatgwdgywvdaasalrmkddaiivldpvnqhvi
    seglkkgiktfvggnctvslmlmaigglfekdlvewisvatyqaasgagaknmrellsqm
    glleqavsselkdpassildierkvtakmradnfptdnfgaalggslipwidkllpetgq
    tkeewkgyaetnkilglsdnpipvdglcvrigalrcnsqaftiklkkdlpleeieqiias
    hnewvkvipndkeitlreltpakvtgtlsvpvgrlrklamgpeylaaftvgdqllwgaae
    pvrrilkqlva