PDB entry 1pqs

View 1pqs on RCSB PDB site
Description: solution structure of the c-terminal opca domain of ycdc24p
Deposited on 2003-06-19, released 2003-07-01
The last revision prior to the SCOP 1.67 freeze date was dated 2003-07-01, with a file datestamp of 2003-07-01.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1pqsa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pqsA (A:)
  seiftllvekvwnfddlimainskisnthnnnispitkikyqdedgdfvvlgsdedwnva
  kemlaennekflnirly