PDB entry 1pqn

View 1pqn on RCSB PDB site
Description: dominant negative human hDim1 (hDim1 1-128)
Class: cell cycle
Keywords: dim1, dominant negative, cell cycle, pre-mRNA splicing, snRNP, U5-15k SPLICEOSOMAL PROTEIN, THIOREDOXIN, TRANSCRIPTION, cleavage
Deposited on 2003-06-18, released 2003-08-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spliceosomal U5 snRNP-specific 15 kDa protein
    Species: Homo sapiens [TaxId:9606]
    Gene: DIM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1pqna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pqnA (A:)
symlphlhngwqvdqailseedrvvvirfghdwdptcmkmdevlysiaekvknfaviylv
ditevpdfnkmyelydpctvmfffrnkhimidlgtgnnnkinwamedkqemvdiietvyr
garkgrg