PDB entry 1pqa

View 1pqa on RCSB PDB site
Description: Trypsin with PMSF at atomic resolution
Class: hydrolase
Keywords: trypsin, atomic resolution, PMSF, catalysis, HYDROLASE
Deposited on 2003-06-18, released 2003-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.23 Å
R-factor: N/A
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: FUSARIUM OXYSPORUM [TaxId:5507]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35049 (0-223)
      • modified residue (179)
    Domains in SCOPe 2.07: d1pqaa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pqaA (A:)
    ivggtsasagdfpfivsisrnggpwcggsllnantvltaahcvsgyaqsgfqiragslsr
    tsggitsslssvrvhpsysgnnndlailklstsipsggnigyarlaasgsdpvagssatv
    agwgatseggsstpvnllkvtvpivsratcraqygtsaitnqmfcagvssggkdscqgds
    ggpivdssntligavswgngcarpnysgvyasvgalrsfidtya