PDB entry 1pq3

View 1pq3 on RCSB PDB site
Description: Human Arginase II: Crystal Structure and Physiological Role in Male and Female Sexual Arousal
Class: hydrolase
Keywords: biosynthetic protein, hydrolase
Deposited on 2003-06-17, released 2003-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.227
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arginase II, mitochondrial precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: ARG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pq3a_
  • Chain 'B':
    Compound: Arginase II, mitochondrial precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: ARG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pq3b_
  • Chain 'C':
    Compound: Arginase II, mitochondrial precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: ARG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pq3c_
  • Chain 'D':
    Compound: Arginase II, mitochondrial precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: ARG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pq3d_
  • Chain 'E':
    Compound: Arginase II, mitochondrial precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: ARG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pq3e_
  • Chain 'F':
    Compound: Arginase II, mitochondrial precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: ARG2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pq3f_
  • Heterogens: SO4, MN, CL, S2C, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pq3A (A:)
    hsvavigapfsqgqkrkgvehgpaaireaglmkrlsslgchlkdfgdlsftpvpkddlyn
    nlivnprsvglanqelaevvsravsdgyscvtlggdhslaigtisgharhcpdlcvvwvd
    ahadintplttssgnlhgqpvsfllrelqdkvpqlpgfswikpcissasivyiglrdvdp
    pehfilknydiqyfsmrdidrlgiqkvmertfdlligkrqrpihlsfdidafdptlapat
    gtpvvggltyregmyiaeeihntgllsaldlvevnpqlatseeeakttanlavdviassf
    gqtreg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pq3B (B:)
    hsvavigapfsqgqkrkgvehgpaaireaglmkrlsslgchlkdfgdlsftpvpkddlyn
    nlivnprsvglanqelaevvsravsdgyscvtlggdhslaigtisgharhcpdlcvvwvd
    ahadintplttssgnlhgqpvsfllrelqdkvpqlpgfswikpcissasivyiglrdvdp
    pehfilknydiqyfsmrdidrlgiqkvmertfdlligkrqrpihlsfdidafdptlapat
    gtpvvggltyregmyiaeeihntgllsaldlvevnpqlatseeeakttanlavdviassf
    gqtreg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pq3C (C:)
    hsvavigapfsqgqkrkgvehgpaaireaglmkrlsslgchlkdfgdlsftpvpkddlyn
    nlivnprsvglanqelaevvsravsdgyscvtlggdhslaigtisgharhcpdlcvvwvd
    ahadintplttssgnlhgqpvsfllrelqdkvpqlpgfswikpcissasivyiglrdvdp
    pehfilknydiqyfsmrdidrlgiqkvmertfdlligkrqrpihlsfdidafdptlapat
    gtpvvggltyregmyiaeeihntgllsaldlvevnpqlatseeeakttanlavdviassf
    gqtreg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pq3D (D:)
    hsvavigapfsqgqkrkgvehgpaaireaglmkrlsslgchlkdfgdlsftpvpkddlyn
    nlivnprsvglanqelaevvsravsdgyscvtlggdhslaigtisgharhcpdlcvvwvd
    ahadintplttssgnlhgqpvsfllrelqdkvpqlpgfswikpcissasivyiglrdvdp
    pehfilknydiqyfsmrdidrlgiqkvmertfdlligkrqrpihlsfdidafdptlapat
    gtpvvggltyregmyiaeeihntgllsaldlvevnpqlatseeeakttanlavdviassf
    gqtreg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pq3E (E:)
    hsvavigapfsqgqkrkgvehgpaaireaglmkrlsslgchlkdfgdlsftpvpkddlyn
    nlivnprsvglanqelaevvsravsdgyscvtlggdhslaigtisgharhcpdlcvvwvd
    ahadintplttssgnlhgqpvsfllrelqdkvpqlpgfswikpcissasivyiglrdvdp
    pehfilknydiqyfsmrdidrlgiqkvmertfdlligkrqrpihlsfdidafdptlapat
    gtpvvggltyregmyiaeeihntgllsaldlvevnpqlatseeeakttanlavdviassf
    gqtreg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pq3F (F:)
    hsvavigapfsqgqkrkgvehgpaaireaglmkrlsslgchlkdfgdlsftpvpkddlyn
    nlivnprsvglanqelaevvsravsdgyscvtlggdhslaigtisgharhcpdlcvvwvd
    ahadintplttssgnlhgqpvsfllrelqdkvpqlpgfswikpcissasivyiglrdvdp
    pehfilknydiqyfsmrdidrlgiqkvmertfdlligkrqrpihlsfdidafdptlapat
    gtpvvggltyregmyiaeeihntgllsaldlvevnpqlatseeeakttanlavdviassf
    gqtreg