PDB entry 1pq2

View 1pq2 on RCSB PDB site
Description: Crystal Structure of Human Drug Metabolizing Cytochrome P450 2C8
Deposited on 2003-06-17, released 2004-01-13
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-30, with a file datestamp of 2004-03-30.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.248
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1pq2a_
  • Chain 'B':
    Domains in SCOP 1.67: d1pq2b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pq2A (A:)
    makktsskgklppgptplpiignmlqidvkdicksftnfskvygpvftvyfgmnpivvfh
    gyeavkealidngeefsgrgnspisqritkglgiissngkrwkeirrfslttlrnfgmgk
    rsiedrvqeeahclveelrktkaspcdptfilgcapcnvicsvvfqkrfdykdqnfltlm
    krfnenfrilnspwiqvcnnfpllidcfpgthnkvlknvaltrsyirekvkehqasldvn
    nprdfidcflikmeqekdnqksefnienlvgtvadlfvagtettsttlryglllllkhpe
    vtakvqeeidhvigrhrspcmqdrshmpytdavvheiqrysdlvptgvphavttdtkfrn
    ylipkgttimalltsvlhddkefpnpnifdpghfldkngnfkksdyfmpfsagkricage
    glarmelflflttilqnfnlksvddlknlnttavtkgivslppsyqicfipvhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pq2A (A:)
    klppgptplpiignmlqidvkdicksftnfskvygpvftvyfgmnpivvfhgyeavkeal
    idngeefsgrgnspisqritkglgiissngkrwkeirrfslttlrnfgmgkrsiedrvqe
    eahclveelrktkaspcdptfilgcapcnvicsvvfqkrfdykdqnfltlmkrfnenfri
    lnspwiqvcnnfpllidcfpgthnkvlknvaltrsyirekvkehqasldvnnprdfidcf
    likmeqekdnqksefnienlvgtvadlfvagtettsttlryglllllkhpevtakvqeei
    dhvigrhrspcmqdrshmpytdavvheiqrysdlvptgvphavttdtkfrnylipkgtti
    malltsvlhddkefpnpnifdpghfldkngnfkksdyfmpfsagkricageglarmelfl
    flttilqnfnlksvddlknlnttavtkgivslppsyqicfipv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pq2B (B:)
    makktsskgklppgptplpiignmlqidvkdicksftnfskvygpvftvyfgmnpivvfh
    gyeavkealidngeefsgrgnspisqritkglgiissngkrwkeirrfslttlrnfgmgk
    rsiedrvqeeahclveelrktkaspcdptfilgcapcnvicsvvfqkrfdykdqnfltlm
    krfnenfrilnspwiqvcnnfpllidcfpgthnkvlknvaltrsyirekvkehqasldvn
    nprdfidcflikmeqekdnqksefnienlvgtvadlfvagtettsttlryglllllkhpe
    vtakvqeeidhvigrhrspcmqdrshmpytdavvheiqrysdlvptgvphavttdtkfrn
    ylipkgttimalltsvlhddkefpnpnifdpghfldkngnfkksdyfmpfsagkricage
    glarmelflflttilqnfnlksvddlknlnttavtkgivslppsyqicfipvhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pq2B (B:)
    klppgptplpiignmlqidvkdicksftnfskvygpvftvyfgmnpivvfhgyeavkeal
    idngeefsgrgnspisqritkglgiissngkrwkeirrfslttlrnfgmgkrsiedrvqe
    eahclveelrktkaspcdptfilgcapcnvicsvvfqkrfdykdqnfltlmkrfnenfri
    lnspwiqvcnnfpllidcfpgthnkvlknvaltrsyirekvkehqasldvnnprdfidcf
    likmeqekdnqksefnienlvgtvadlfvagtettsttlryglllllkhpevtakvqeei
    dhvigrhrspcmqdrshmpytdavvheiqrysdlvptgvphavttdtkfrnylipkgtti
    malltsvlhddkefpnpnifdpghfldkngnfkksdyfmpfsagkricageglarmelfl
    flttilqnfnlksvddlknlnttavtkgivslppsyqicfipv