PDB entry 1pq0

View 1pq0 on RCSB PDB site
Description: Crystal structure of mouse Bcl-xl
Class: apoptosis
Keywords: bcl-xl, APOPTOSIS
Deposited on 2003-06-17, released 2003-09-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.217
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apoptosis regulator bcl-x
    Species: Mus musculus [TaxId:10090]
    Gene: BCL2L1 OR BCL2L OR BCLX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1pq0a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pq0A (A:)
    msqsnrelvvdflsyklsqkgyswsqfsdveenrteapeeteaeretpsaingnpswhla
    dspavngatghsssldarevipmaavkqalreagdefelryrrafsdltsqlhitpgtay
    qsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaswmatylndhlep
    wiqenggwdtfvdlyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pq0A (A:)
    sqsnrelvvdflsyklsqkgyswsqfsdipmaavkqalreagdefelryrrafsdltsql
    hitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaswmat
    ylndhlepwiqenggwdtfvdlyg