PDB entry 1ppw

View 1ppw on RCSB PDB site
Description: isopentenylpyrophosphate-dimethylallylpyrophosphate isomerase in complex with the bromohydrine of ipp
Deposited on 2003-06-17, released 2004-06-24
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-24, with a file datestamp of 2004-06-24.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.202
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ppwa_
  • Chain 'B':
    Domains in SCOP 1.69: d1ppwb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ppwA (A:)
    mqtehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpg
    vwtnsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpv
    faarttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftq
    lkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppwA (A:)
    ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
    nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
    rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaft
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ppwB (B:)
    mqtehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpg
    vwtnsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpv
    faarttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftq
    lkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppwB (B:)
    ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
    nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
    rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftqlkl