PDB entry 1ppv

View 1ppv on RCSB PDB site
Description: isopentenylpyrophosphate-dimethylallylpyrophosphate isomerase in complex with the bromohydrine of ipp
Deposited on 2003-06-17, released 2004-06-29
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-29, with a file datestamp of 2004-06-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.195
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ppva_
  • Chain 'B':
    Domains in SCOP 1.69: d1ppvb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ppvA (A:)
    mqtehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpg
    vwtnsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpv
    faarttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftq
    lkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppvA (A:)
    ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
    nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
    rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaft
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ppvB (B:)
    mqtehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpg
    vwtnsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpv
    faarttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftq
    lkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppvB (B:)
    ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
    nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
    rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftqlkl