PDB entry 1ppq

View 1ppq on RCSB PDB site
Description: NMR structure of 16th module of Immune Adherence Receptor, Cr1 (Cd35)
Class: immune system
Keywords: Complement, Module, CCP, SCR, Sushi, Structure, IMMUNE SYSTEM
Deposited on 2003-06-17, released 2004-05-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: complement receptor type 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CR1 OR C3BR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17927 (4-67)
      • cloning artifact (0-3)
      • engineered (30)
    Domains in SCOPe 2.06: d1ppqa1, d1ppqa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ppqA (A:)
    eaeakscktppdpvngmvhvitdiqvgsrityscttghrlighssaecilsgntahwstk
    ppicqrip