PDB entry 1ppp

View 1ppp on RCSB PDB site
Description: crystal structure of papain-e64-c complex. binding diversity of e64-c to papain s2 and s3 subsites
Class: hydrolase(sulfhydryl proteinase)
Keywords: hydrolase(sulfhydryl proteinase)
Deposited on 1993-03-17, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.194
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: papain
    Species: Carica papaya [TaxId:3649]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00784 (0-211)
      • conflict (46)
      • conflict (117)
      • conflict (134)
    Domains in SCOPe 2.08: d1pppa_
  • Heterogens: E6C, MOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pppA (A:)
    ipeyvdwrqkgavtpvknqgscgscwafsavvtiegiikirtgnlnqyseqelldcdrrs
    ygcnggypwsalqlvaqygihyrntypyegvqrycrsrekgpyaaktdgvrqvqpynqga
    llysianqpvsvvlqaagkdfqlyrggifvgpcgnkvdhavaavgygpnyiliknswgtg
    wgengyirikrgtgnsygvcglytssfypvkn