PDB entry 1pph

View 1pph on RCSB PDB site
Description: geometry of binding of the nalpha-tosylated piperidides of m-amidino-, p-amidino-and p-guanidino phenylalanine to thrombin and trypsin: x-ray crystal structures of their trypsin complexes and modeling of their thrombin complexes
Class: hydrolase(serine proteinase)
Keywords: hydrolase(serine proteinase)
Deposited on 1991-10-24, released 1994-01-31
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.167
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'E':
  Compound: Trypsin
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00760 (0-222)
  Domains in SCOP 1.75: d1pphe_
• Heterogens: CA, SO4, APM, TOS, HOH

PDB Chain Sequences:

• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pphE (E:)
  ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
  neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
  wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
  vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn