PDB entry 1pph

View 1pph on RCSB PDB site
Description: geometry of binding of the nalpha-tosylated piperidides of m-amidino-, p-amidino-and p-guanidino phenylalanine to thrombin and trypsin: x-ray crystal structures of their trypsin complexes and modeling of their thrombin complexes
Class: HYDROLASE/hydrolase inhibitor
Keywords: SERINE PROTEINASE, HYDROLASE-hydrolase inhibitor complex
Deposited on 1991-10-24, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.167
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Trypsin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pphe_
  • Heterogens: CA, SO4, 0ZG, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pphE (E:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn