PDB entry 1ppd

View 1ppd on RCSB PDB site
Description: restrained least-squares refinement of the sulfhydryl protease papain to 2.0 angstroms
Class: hydrolase (sulfhydryl proteinase)
Keywords: hydrolase (sulfhydryl proteinase)
Deposited on 1984-11-06, released 1985-01-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-hydroxyethyl-thiopapain
    Species: Carica papaya [TaxId:3649]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00784 (0-211)
      • conflict (46)
      • conflict (117)
      • conflict (134)
    Domains in SCOPe 2.08: d1ppda_
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ppdA (A:)
    ipeyvdwrqkgavtpvknqgscgscwafsavvtiegiikirtgnlnqyseqelldcdrrs
    ygcnggypwsalqlvaqygihyrntypyegvqrycrsrekgpyaaktdgvrqvqpynqga
    llysianqpvsvvlqaagkdfqlyrggifvgpcgnkvdhavaavgygpnyiliknswgtg
    wgengyirikrgtgnsygvcglytssfypvkn