PDB entry 1ppc

View 1ppc on RCSB PDB site
Description: geometry of binding of the benzamidine-and arginine-based inhibitors n-alpha-(2-naphthyl-sulphonyl-glycyl)-dl-p-amidinophenylalanyl-piperidine (napap) and (2r,4r)-4-methyl-1-[n-alpha-(3-methyl-1,2,3,4-tetrahydro-8-quinolinesulphonyl)-l-arginyl]-2-piperidine carboxylic acid (mqpa) to human alpha-thrombin: x-ray crystallographic determination of the napap-trypsin complex and modeling of napap-thrombin and mqpa-thrombin
Class: HYDROLASE/hydrolase inhibitor
Keywords: SERINE PROTEINASE, HYDROLASE-hydrolase inhibitor complex
Deposited on 1991-10-24, released 1994-01-31
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1ppce_
  • Heterogens: MID, CA, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ppcE (E:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn