PDB entry 1ppc

View 1ppc on RCSB PDB site
Description: geometry of binding of the benzamidine-and arginine-based inhibitors n-alpha-(2-naphthyl-sulphonyl-glycyl)-dl-p-amidinophenylalanyl-piperidine (napap) and (2r,4r)-4-methyl-1-[n-alpha-(3-methyl-1,2,3,4-tetrahydro-8-quinolinesulphonyl)-l-arginyl]-2-piperidine carboxylic acid (mqpa) to human alpha-thrombin: x-ray crystallographic determination of the napap-trypsin complex and modeling of napap-thrombin and mqpa-thrombin
Deposited on 1991-10-24, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'E':
  Domains in SCOP 1.55: d1ppce_

PDB Chain Sequences:

• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ppcE (E:)
  ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
  neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
  wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
  vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn