PDB entry 1ppa

View 1ppa on RCSB PDB site
Description: the crystal structure of a lysine 49 phospholipase a2 from the venom of the cottonmouth snake at 2.0 angstroms resolution
Class: hydrolase(carboxylic esterase)
Keywords: hydrolase(carboxylic esterase)
Deposited on 1991-10-29, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.157
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Agkistrodon piscivorus piscivorus [TaxId:8716]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ppaa_
  • Heterogens: ANL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ppaA (A:)
    svlelgkmilqetgknaitsygsygcncgwghrgqpkdatdrccfvhkccykkltdcnhk
    tdrysyswknkaiiceeknpclkemcecdkavaiclrenldtynkkykayfklkckkpdt
    c