PDB entry 1ppa

View 1ppa on RCSB PDB site
Description: the crystal structure of a lysine 49 phospholipase a2 from the venom of the cottonmouth snake at 2.0 angstroms resolution
Deposited on 1991-10-29, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.157
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1ppa__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ppa_ (-)
  svlelgkmilqetgknaitsygsygcncgwghrgqpkdatdrccfvhkccykkltdcnhk
  tdrysyswknkaiiceeknpclkemcecdkavaiclrenldtynkkykayfklkckkpdt
  c