PDB entry 1pp8

View 1pp8 on RCSB PDB site
Description: crystal structure of the T. vaginalis IBP39 Initiator binding domain (IBD) bound to the alpha-SCS Inr element
Deposited on 2003-06-16, released 2003-11-18
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-18, with a file datestamp of 2003-11-18.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: 0.269
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Domains in SCOP 1.67: d1pp8f_
  • Chain 'M':
    Domains in SCOP 1.67: d1pp8m_
  • Chain 'O':
    Domains in SCOP 1.67: d1pp8o_
  • Chain 'P':
    Domains in SCOP 1.67: d1pp8p_
  • Chain 'U':
    Domains in SCOP 1.67: d1pp8u_
  • Chain 'V':
    Domains in SCOP 1.67: d1pp8v_

PDB Chain Sequences:

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1pp8F (F:)
    mdsndleasftsrlppeivaalkrkssrdpnsrfprklhmlltylasnpqleeeiglswi
    sdtefkmkkknvalvmgiklntlnvnlrdlafeqlqhdkggwtqwkrsgftrnsvfedpt
    qndspmhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pp8F (F:)
    dsndleasftsrlppeivaalkrkssrdpnsrfprklhmlltylasnpqleeeiglswis
    dtefkmkkknvalvmgiklntlnvnlrdlafeqlqhdkggwtqwkrsgftrns
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1pp8M (M:)
    mdsndleasftsrlppeivaalkrkssrdpnsrfprklhmlltylasnpqleeeiglswi
    sdtefkmkkknvalvmgiklntlnvnlrdlafeqlqhdkggwtqwkrsgftrnsvfedpt
    qndspmhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pp8M (M:)
    mdsndleasftsrlppeivaalkrkssrdpnsrfprklhmlltylasnpqleeeiglswi
    sdtefkmkkknvalvmgiklntlnvnlrdlafeqlqhdkggwtqwkrsgftrnsvfed
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1pp8O (O:)
    mdsndleasftsrlppeivaalkrkssrdpnsrfprklhmlltylasnpqleeeiglswi
    sdtefkmkkknvalvmgiklntlnvnlrdlafeqlqhdkggwtqwkrsgftrnsvfedpt
    qndspmhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pp8O (O:)
    ftsrlppeivaalkrfprklhmlltylasnpqleeeiglswisdtefkmkkknvalvmgi
    klntlnvnlrdlafeqlqhdkggwtqwkrsgftrnsv
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1pp8P (P:)
    mdsndleasftsrlppeivaalkrkssrdpnsrfprklhmlltylasnpqleeeiglswi
    sdtefkmkkknvalvmgiklntlnvnlrdlafeqlqhdkggwtqwkrsgftrnsvfedpt
    qndspmhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pp8P (P:)
    mdsndleasftsrlppeivaalkrkssrdpnsrfprklhmlltylasnpqleeeiglswi
    sdtefkmkkknvalvmgiklntlnvnlrdlafeqlqhdkggwtqwkrsgftrnsvfed
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1pp8U (U:)
    mdsndleasftsrlppeivaalkrkssrdpnsrfprklhmlltylasnpqleeeiglswi
    sdtefkmkkknvalvmgiklntlnvnlrdlafeqlqhdkggwtqwkrsgftrnsvfedpt
    qndspmhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pp8U (U:)
    dsndleasftsrlppeivaalkrkssrdpnsrfprklhmlltylasnpqleeeiglswis
    dtefkmkkknvalvmgiklntlnvnlrdlafeqlqhdkggwtqwkrsgftr
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1pp8V (V:)
    mdsndleasftsrlppeivaalkrkssrdpnsrfprklhmlltylasnpqleeeiglswi
    sdtefkmkkknvalvmgiklntlnvnlrdlafeqlqhdkggwtqwkrsgftrnsvfedpt
    qndspmhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pp8V (V:)
    sftsrlppeivaalkrfprklhmlltylasnpqleeeiglswisdtefkmkkknvalvmg
    iklntlnvnlrdlafeqlqhdkggwtqwkrsgftrnsv