PDB entry 1pp7

View 1pp7 on RCSB PDB site
Description: Crystal structure of the T. vaginalis Initiator binding protein bound to the ferredoxin Inr
Deposited on 2003-06-16, released 2003-11-18
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-18, with a file datestamp of 2003-11-18.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.197
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'U':
    Domains in SCOP 1.67: d1pp7u_

PDB Chain Sequences:

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1pp7U (U:)
    mdsndleasftsrlppeivaalkrkssrdpnsrfprklhmlltylasnpqleeeiglswi
    sdtefkmkkknvalvmgiklntlnvnlrdlafeqlqhdkggwtqwkrsgftrnsvfedpt
    qndspmhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pp7U (U:)
    dleasftsrlppeivaalkrkssrdpnsrfprklhmlltylasnpqleeeiglswisdte
    fkmkkknvalvmgiklntlnvnlrdlafeqlqhdkggwtqwkrsgftrnsvfed