PDB entry 1pp3

View 1pp3 on RCSB PDB site
Description: Structure of thaumatin in a hexagonal space group
Class: plant protein
Keywords: plant protein
Deposited on 2003-06-16, released 2004-08-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.211
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thaumatin I
    Species: THAUMATOCOCCUS DANIELLII [TaxId:4621]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pp3a_
  • Chain 'B':
    Compound: thaumatin I
    Species: THAUMATOCOCCUS DANIELLII [TaxId:4621]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pp3b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pp3A (A:)
    atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
    sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
    crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
    fsyvldkpttvtcpgssnyrvtfcpta
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pp3B (B:)
    atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
    sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
    crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
    fsyvldkpttvtcpgssnyrvtfcpta