PDB entry 1pp2

View 1pp2 on RCSB PDB site
Description: the refined crystal structure of dimeric phospholipase a2 at 2.5 angstroms. access to a shielded catalytic center
Class: hydrolase
Keywords: hydrolase
Deposited on 1986-03-10, released 1986-05-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.178
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound: calcium-free phospholipase a2
    Species: Crotalus atrox [TaxId:8730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pp2l_
  • Chain 'R':
    Compound: calcium-free phospholipase a2
    Species: Crotalus atrox [TaxId:8730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pp2r_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pp2L (L:)
slvqfetlimkiagrsgllwysaygcycgwgghglpqdatdrccfvhdccygkatdcnpk
tvsytyseengeiicggddpcgtqicecdkaaaicfrdnipsydnkywlfppkdcreepe
pc

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pp2R (R:)
slvqfetlimkiagrsgllwysaygcycgwgghglpqdatdrccfvhdccygkatdcnpk
tvsytyseengeiicggddpcgtqicecdkaaaicfrdnipsydnkywlfppkdcreepe
pc