PDB entry 1pp0

View 1pp0 on RCSB PDB site
Description: volvatoxin A2 in monoclinic crystal
Class: toxin
Keywords: volvatoxin A2, ingot crystal form
Deposited on 2003-06-16, released 2004-08-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: 0.229
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: volvatoxin A2
    Species: Volvariella volvacea [TaxId:36659]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pp0a_
  • Chain 'B':
    Compound: volvatoxin A2
    Species: Volvariella volvacea [TaxId:36659]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pp0b_
  • Chain 'C':
    Compound: volvatoxin A2
    Species: Volvariella volvacea [TaxId:36659]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pp0c_
  • Chain 'D':
    Compound: volvatoxin A2
    Species: Volvariella volvacea [TaxId:36659]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pp0d_
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pp0A (A:)
    asddnvfqpvdqlpedlipssiqvlkfsgkylkleqdkayfdwpgfktaidnytgedlsf
    dkydqstinqqsqevgamvdkiakflhdafaavvdlsklaaiilntftnleeesssgflq
    fntnnvkknssweyrvlfsvpfgdnapsyfyslvttilitadieektgwwgltsstkknf
    avqidalelvvkkgfkapn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pp0A (A:)
    nvfqpvdqlpedlipssiqvlkfsgkylkleqdkayfdwpgfktaidnytgedlsfdkyd
    qstinqqsqevgamvdkiakflhdafaavvdlsklaaiilntftnleeesssgflqfntn
    nvkknssweyrvlfsvpfapsyfyslvttilitadieektgwwgltsstkknfavqidal
    elvvkkgfkap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pp0B (B:)
    asddnvfqpvdqlpedlipssiqvlkfsgkylkleqdkayfdwpgfktaidnytgedlsf
    dkydqstinqqsqevgamvdkiakflhdafaavvdlsklaaiilntftnleeesssgflq
    fntnnvkknssweyrvlfsvpfgdnapsyfyslvttilitadieektgwwgltsstkknf
    avqidalelvvkkgfkapn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pp0B (B:)
    nvfqpvdqlpedlipssiqvlkfsgkylkleqdkayfdwpgfktaidnytgedlsfdkyd
    qstinqqsqevgamvdkiakflhdafaavvdlsklaaiilntftnleeesssgflqfntn
    nvkknssweyrvlfsvpfgdnapsyfyslvttilitadieektgwwgltsstkknfavqi
    dalelvvkkgfkap
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pp0C (C:)
    asddnvfqpvdqlpedlipssiqvlkfsgkylkleqdkayfdwpgfktaidnytgedlsf
    dkydqstinqqsqevgamvdkiakflhdafaavvdlsklaaiilntftnleeesssgflq
    fntnnvkknssweyrvlfsvpfgdnapsyfyslvttilitadieektgwwgltsstkknf
    avqidalelvvkkgfkapn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pp0C (C:)
    nvfqpvdqlpedlipssiqvlkfsgkylkleqdkayfdwpgfktaidnytgedlsfdkyd
    qstinqqsqevgamvdkiakflhdafaavvdlsklaaiilntftnleeesssgflqfntn
    nvkknssweyrvlfsvpfgdnapsyfyslvttilitadieektgwwgltsstkknfavqi
    dalelvvkkgfkap
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pp0D (D:)
    asddnvfqpvdqlpedlipssiqvlkfsgkylkleqdkayfdwpgfktaidnytgedlsf
    dkydqstinqqsqevgamvdkiakflhdafaavvdlsklaaiilntftnleeesssgflq
    fntnnvkknssweyrvlfsvpfgdnapsyfyslvttilitadieektgwwgltsstkknf
    avqidalelvvkkgfkapn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pp0D (D:)
    nvfqpvdqlpedlipssiqvlkfsgkylkleqdkayfdwpgfktaidnytgedlsfdkyd
    qstinqqsqevgamvdkiakflhdafaavvdlsklaaiilntftnleeesssgflqfntn
    nvkknssweyrvlfsvpfapsyfyslvttilitadieektgwwgltsstkknfavqidal
    elvvkkgfkap