PDB entry 1poz

View 1poz on RCSB PDB site
Description: solution structure of the hyaluronan binding domain of human cd44
Class: cell adhesion
Keywords: hyaluronan-binding domain, carbohydrate-binding domain, link module, cell adhesion, glycoprotein
Deposited on 2003-06-16, released 2004-03-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CD44 antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: CD44
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1poza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pozA (A:)
    aqidlnitcrfagvfhvekngrysisrteaadlckafnstlptmaqmekalsigfetcry
    gfieghvviprihpnsicaanntgvyiltsntsqydtycfnasappeedctsvtdlpnaf
    dgpititivnrdgtryvqkgeyrtnpediypsnptdddv