PDB entry 1pou

View 1pou on RCSB PDB site
Description: the solution structure of the oct-1 pou-specific domain reveals a striking similarity to the bacteriophage lambda repressor DNA-binding domain
Class: DNA-binding protein
Keywords: DNA-binding protein
Deposited on 1993-06-14, released 1994-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: oct-1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14859 (0-70)
  Domains in SCOPe 2.06: d1poua_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pouA (A:)
  dleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmcklk
  pllekwlndae