PDB entry 1pou

View 1pou on RCSB PDB site
Description: the solution structure of the oct-1 pou-specific domain reveals a striking similarity to the bacteriophage lambda repressor dna-binding domain
Deposited on 1993-06-14, released 1994-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1994-10-15, with a file datestamp of 1994-10-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1pou__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pou_ (-)
    dleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmcklk
    pllekwlndae