PDB entry 1poq

View 1poq on RCSB PDB site
Description: Solution Structure of a Superantigen from Yersinia pseudotuberculosis
Class: immune system
Keywords: Jelly roll fold, IMMUNE SYSTEM
Deposited on 2003-06-16, released 2004-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ypm
    Species: Yersinia pseudotuberculosis [TaxId:633]
    Gene: ypma
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1poqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1poqA (A:)
ripniatytgtiqgkgevciignkegktrggelyavlhstnvnadmtlillrnvggngwg
eikrndidkplkyedyytsglswiwkiknnssetsnysldatvhddkedsdvltkcpv