PDB entry 1pop

View 1pop on RCSB PDB site
Description: x-ray crystallographic structure of a papain-leupeptin complex
Class: hydrolase(thiol protease)
Keywords: hydrolase(thiol protease)
Deposited on 1993-06-24, released 1993-10-31
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: papain
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00784 (0-211)
      • conflict (46)
      • conflict (117)
      • conflict (134)
    Domains in SCOP 1.75: d1popa_
  • Chain 'B':
    Compound: leupeptin
  • Heterogens: ACE, MOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1popA (A:)
ipeyvdwrqkgavtpvknqgscgscwafsavvtiegiikirtgnlnqyseqelldcdrrs
ygcnggypwsalqlvaqygihyrntypyegvqrycrsrekgpyaaktdgvrqvqpynqga
llysianqpvsvvlqaagkdfqlyrggifvgpcgnkvdhavaavgygpnyiliknswgtg
wgengyirikrgtgnsygvcglytssfypvkn

  • Chain 'B':
    No sequence available.