PDB entry 1pon

View 1pon on RCSB PDB site
Description: site iii-site iv troponin c heterodimer, nmr
Deposited on 1996-04-02, released 1996-11-08
The last revision prior to the SCOP 1.57 freeze date was dated 1996-11-08, with a file datestamp of 1996-11-08.
Experiment type: NMR42
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1pon.1
  • Chain 'B':
    Domains in SCOP 1.57: d1pon.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ponA (A:)
kseeelanafrifdknadgyidieelgeilratg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ponB (B:)
vteediedlmkdsdknndgridfdeflkmmegvq