PDB entry 1pok

View 1pok on RCSB PDB site
Description: Crystal structure of Isoaspartyl Dipeptidase
Class: hydrolase
Keywords: hydrolase
Deposited on 2003-06-15, released 2004-06-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.209
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isoaspartyl dipeptidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39377 (0-End)
      • modified residue (161)
    Domains in SCOPe 2.04: d1poka1, d1poka2
  • Chain 'B':
    Compound: Isoaspartyl dipeptidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39377 (0-End)
      • modified residue (161)
    Domains in SCOPe 2.04: d1pokb1, d1pokb2
  • Heterogens: SO4, ZN, ASN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pokA (A:)
    midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
    cpgfidqhvhliggggeagpttrtpevalsrlteagvtsvvgllgtdsisrhpesllakt
    ralneegisawmltgayhvpsrtitgsvekdvaiidrvigvkcaisdhrsaapdvyhlan
    maaesrvggllggkpgvtvfhmgdskkalqpiydllencdvpiskllpthvnrnvplfeq
    alefarkggtiditssidepvapaegiaravqagiplarvtlssdgngsqpffddegnlt
    higvagfetlletvqvlvkdydfsisdalrpltssvagflnltgkgeilpgndadllvmt
    pelrieqvyargklmvkdgkacvkgtfeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pokA (A:)
    midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
    cpgfidqhvhliggggeagpttrtpevalsrlteagvtsvvgllgtdsisrhpesllakt
    ralneegisawmltgayhvpsrtitgsvekdvaiidrvigvkcaisdhrsaapdvyhlan
    maaesrvggllggkpgvtvfhmgdskkalqpiydllencdvpiskllpthvnrnvplfeq
    alefarkggtiditssidepvapaegiaravqagiplarvtlssdgngshigvagfetll
    etvqvlvkdydfsisdalrpltssvagflnltgkgeilpgndadllvmtpelrieqvyar
    gklmvkdgkacvkgtfe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pokB (B:)
    midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
    cpgfidqhvhliggggeagpttrtpevalsrlteagvtsvvgllgtdsisrhpesllakt
    ralneegisawmltgayhvpsrtitgsvekdvaiidrvigvkcaisdhrsaapdvyhlan
    maaesrvggllggkpgvtvfhmgdskkalqpiydllencdvpiskllpthvnrnvplfeq
    alefarkggtiditssidepvapaegiaravqagiplarvtlssdgngsqpffddegnlt
    higvagfetlletvqvlvkdydfsisdalrpltssvagflnltgkgeilpgndadllvmt
    pelrieqvyargklmvkdgkacvkgtfeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pokB (B:)
    midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
    cpgfidqhvhliggggeagpttrtpevalsrlteagvtsvvgllgtdsisrhpesllakt
    ralneegisawmltgayhvpsrtitgsvekdvaiidrvigvkcaisdhrsaapdvyhlan
    maaesrvggllggkpgvtvfhmgdskkalqpiydllencdvpiskllpthvnrnvplfeq
    alefarkggtiditssidepvapaegiaravqagiplarvtlssdgngsvagfetlletv
    qvlvkdydfsisdalrpltssvagflnltgkgeilpgndadllvmtpelrieqvyargkl
    mvkdgkacvkgtfe