PDB entry 1poj

View 1poj on RCSB PDB site
Description: Isoaspartyl Dipeptidase with bound inhibitor
Class: hydrolase
Keywords: hydrolase
Deposited on 2003-06-15, released 2004-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.244
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isoaspartyl dipeptidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39377 (0-End)
      • modified residue (161)
    Domains in SCOPe 2.07: d1poja1, d1poja2
  • Chain 'B':
    Compound: Isoaspartyl dipeptidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39377 (0-End)
      • modified residue (161)
    Domains in SCOPe 2.07: d1pojb1, d1pojb2
  • Heterogens: ZN, AE1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pojA (A:)
    midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
    cpgfidqhvhliggggeagpttrtpevalsrlteagvtsvvgllgtdsisrhpesllakt
    ralneegisawmltgayhvpsrtitgsvekdvaiidrvigvkcaisdhrsaapdvyhlan
    maaesrvggllggkpgvtvfhmgdskkalqpiydllencdvpiskllpthvnrnvplfeq
    alefarkggtiditssidepvapaegiaravqagiplarvtlssdgngsqpffddegnlt
    higvagfetlletvqvlvkdydfsisdalrpltssvagflnltgkgeilpgndadllvmt
    pelrieqvyargklmvkdgkacvkgtfeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pojA (A:)
    midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
    cpgfidqhvhliggggeagpttrtpevalsrlteagvtsvvgllgtdsisrhpesllakt
    ralneegisawmltgayhvpsrtitgsvekdvaiidrvigvkcaisdhrsaapdvyhlan
    maaesrvggllggkpgvtvfhmgdskkalqpiydllencdvpiskllpthvnrnvplfeq
    alefarkggtiditssidepvapaegiaravqagiplarvtlssdgngsqpffddegnlt
    higvagfetlletvqvlvkdydfsisdalrpltssvagflnltgkgeilpgndadllvmt
    pelrieqvyargklmvkdgkacvkgtfe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pojB (B:)
    midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
    cpgfidqhvhliggggeagpttrtpevalsrlteagvtsvvgllgtdsisrhpesllakt
    ralneegisawmltgayhvpsrtitgsvekdvaiidrvigvkcaisdhrsaapdvyhlan
    maaesrvggllggkpgvtvfhmgdskkalqpiydllencdvpiskllpthvnrnvplfeq
    alefarkggtiditssidepvapaegiaravqagiplarvtlssdgngsqpffddegnlt
    higvagfetlletvqvlvkdydfsisdalrpltssvagflnltgkgeilpgndadllvmt
    pelrieqvyargklmvkdgkacvkgtfeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pojB (B:)
    midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
    cpgfidqhvhliggggeagpttrtpevalsrlteagvtsvvgllgtdsisrhpesllakt
    ralneegisawmltgayhvpsrtitgsvekdvaiidrvigvkcaisdhrsaapdvyhlan
    maaesrvggllggkpgvtvfhmgdskkalqpiydllencdvpiskllpthvnrnvplfeq
    alefarkggtiditssidepvapaegiaravqagiplarvtlssdgngsqpffddegnlt
    higvagfetlletvqvlvkdydfsisdalrpltssvagflnltgkgeilpgndadllvmt
    pelrieqvyargklmvkdgkacvkgtfe