PDB entry 1poh

View 1poh on RCSB PDB site
Description: the 2.0 angstroms resolution structure of escherichia coli histidine-containing phosphocarrier protein hpr: a redetermination
Class: phosphotransferase
Keywords: phosphotransferase
Deposited on 1993-10-19, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: histidine-containing phosphocarrier protein hpr
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AA04 (0-84)
  Domains in SCOPe 2.08: d1poha_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pohA (A:)
  mfqqevtitapnglhtrpaaqfvkeakgftseitvtsngksasakslfklqtlgltqgtv
  vtisaegedeqkavehlvklmaele