PDB entry 1pog

View 1pog on RCSB PDB site
Description: solution structure of the oct-1 pou-homeo domain determined by nmr and restrained molecular dynamics
Deposited on 1994-10-12, released 1995-07-31
The last revision prior to the SCOP 1.55 freeze date was dated 1995-07-31, with a file datestamp of 1995-08-14.
Experiment type: NMR13
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1pog__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pog_ (-)
    rrrkkrtsietnirvaleksflenqkptseeitmiadqlnmekevirvwfcnrrqkekri
    di