PDB entry 1poc

View 1poc on RCSB PDB site
Description: crystal structure of bee-venom phospholipase a2 in a complex with a transition-state analogue
Deposited on 1992-09-07, released 1993-10-31
The last revision prior to the SCOP 1.69 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1poc__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1poc_ (-)
    iiypgtlwcghgnkssgpnelgrfkhtdaccrthdmcpdvmsageskhgltntashtrls
    cdcddkfydclknsadtissyfvgkmyfnlidtkcyklehpvtgcgertegrclhytvdk
    skpkvyqwfdlrky