PDB entry 1pob

View 1pob on RCSB PDB site
Description: crystal structure of cobra-venom phospholipase a2 in a complex with a transition-state analogue
Class: hydrolase
Keywords: hydrolase
Deposited on 1992-09-07, released 1993-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Naja atra [TaxId:8656]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00598 (0-117)
    • conflict (106)
    • conflict (108)
    • conflict (112)
  Domains in SCOPe 2.06: d1poba_
• Chain 'B':
  Compound: phospholipase a2
  Species: Naja atra [TaxId:8656]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00598 (0-117)
    • conflict (106)
    • conflict (108)
    • conflict (112)
  Domains in SCOPe 2.06: d1pobb_
• Heterogens: CA, GEL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pobA (A:)
  nlyqfknmiqctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
  wpyfktysyecsqgtltckggnnacaaavcdcdrlaaicfagapyndndyninlkarc
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pobB (B:)
  nlyqfknmiqctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
  wpyfktysyecsqgtltckggnnacaaavcdcdrlaaicfagapyndndyninlkarc