PDB entry 1pob

View 1pob on RCSB PDB site
Description: crystal structure of cobra-venom phospholipase a2 in a complex with a transition-state analogue
Deposited on 1992-09-07, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1poba_
  • Chain 'B':
    Domains in SCOP 1.55: d1pobb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pobA (A:)
nlyqfknmiqctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
wpyfktysyecsqgtltckggnnacaaavcdcdrlaaicfagapyndndyninlkarc

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pobB (B:)
nlyqfknmiqctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
wpyfktysyecsqgtltckggnnacaaavcdcdrlaaicfagapyndndyninlkarc