PDB entry 1poa

View 1poa on RCSB PDB site
Description: interfacial catalysis: the mechanism of phospholipase a2
Deposited on 1992-09-07, released 1993-10-31
The last revision prior to the SCOP 1.69 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.5 Å
R-factor: 0.143
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1poa__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1poa_ (-)
    nlyqfknmiqctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
    wpyfktysyecsqgtltckggnnacaaavcdcdrlaaicfagapyndndyninlkarc