PDB entry 1poa

View 1poa on RCSB PDB site
Description: interfacial catalysis: the mechanism of phospholipase a2
Class: hydrolase
Keywords: hydrolase
Deposited on 1992-09-07, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Naja atra [TaxId:8656]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00598 (0-117)
    • conflict (106)
    • conflict (108)
    • conflict (112)
  Domains in SCOPe 2.08: d1poaa_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1poaA (A:)
  nlyqfknmiqctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
  wpyfktysyecsqgtltckggnnacaaavcdcdrlaaicfagapyndndyninlkarc