PDB entry 1po8

View 1po8 on RCSB PDB site
Description: Crystal structure of a complex formed between krait venom phospholipase A2 and heptanoic acid at 2.7 A resolution.
Class: hydrolase
Keywords: Phospholipase A2, crystal structure,inhibitor,complex, HYDROLASE
Deposited on 2003-06-14, released 2004-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: 0.207
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Bungarus caeruleus [TaxId:132961]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1po8a_
  • Heterogens: NA, SHV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1po8A (A:)
    nlyqlmnmiqcantrtwpsytnygcycgkggsgtpvddldrccythdhcyndaknidgcn
    pvtktysytcteptitcndskdkcarfvcdcdrtaaicfakapyntsnvmirstnscq