PDB entry 1po6

View 1po6 on RCSB PDB site
Description: Crystal Structure of UP1 Complexed With d(TAGG(6MI)TTAGGG): A Human Telomeric Repeat Containing 6-methyl-8-(2-deoxy-beta-ribofuranosyl)isoxanthopteridine (6MI)
Class: RNA Binding Protein/DNA
Keywords: protein-DNA complex, UP1, human telomeric repeat, hTR, TR2-6F, RRM, RNA Recognition Motif, 6MI, 6-methyl-8-(2-deoxy-beta-ribofuranosyl)isoxanthopteridine, hnRNP A1, RNA Binding Protein/DNA COMPLEX
Deposited on 2003-06-13, released 2003-11-11
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.234
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heterogeneous nuclear ribonucleoprotein a1
    Species: Homo sapiens [TaxId:9606]
    Gene: HNRPA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1po6a1, d1po6a2
  • Chain 'B':
    Compound: 5'-d(*t*ap*gp*gp*(6mi)p*tp*tp*ap*gp*gp*g)-3'
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1po6A (A:)
kepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfvtyatvee
vdaamnarphkvdgrvvepkravsredsqrpgahltvkkifvggikedteehhlrdyfeq
ygkievieimtdrgsgkkrgfafvtfddhdsvdkiviqkyhtvnghncevrkalskqema
sas

  • Chain 'B':
    No sequence available.