PDB entry 1po5

View 1po5 on RCSB PDB site
Description: Structure of mammalian cytochrome P450 2B4
Class: oxidoreductase
Keywords: oxidoreductase, membrane protein, cyp 2B4, cyp LM2, cytochrome P450, monooxygenase
Deposited on 2003-06-13, released 2003-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.217
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 2B4
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene: 2B4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00178 (Start-471)
      • engineered (9)
      • see remark 999 (201)
      • expression tag (472)
    Domains in SCOPe 2.07: d1po5a1, d1po5a2
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1po5A (A:)
    makktsskgklppgpsplpvlgnllqmdrkgllrsflrlrekygdvftvylgsrpvvvlc
    gtdairealvdqaeafsgrgkiavvdpifqgygvifangerwralrrfslatmrdfgmgk
    rsveeriqeearclveelrkskgalldntllfhsitsniicsivfgkrfdykdpvflrll
    dlffqsfslissfssqvfelfsgflkhfpgthrqiyrnlqeintfigqsvekhratldps
    nprdfidvyllrmekdksdpssefhhqnliltvlslffagtettsttlrygfllmlkyph
    vtervqkeieqvigshrppalddrakmpytdaviheiqrlgdlipfgvphtvtkdtqfrg
    yvipkntevfpvlssalhdpryfetpntfnpghfldangalkrnegfmpfslgkriclge
    giartelflffttilqnfsiaspvppedidltpresgvgnvppsyqirflarhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1po5A (A:)
    gklppgpsplpvlgnllqmdrkgllrsflrlrekygdvftvylgsrpvvvlcgtdairea
    lvdqaeafsgrgkiavvdpifqgygvifangerwralrrfslatmrdfgmgkrsveeriq
    eearclveelrkskgalldntllfhsitsniicsivfgkrfdykdpvflrlldlffqsfs
    lissfssqvfelfsgflkhfpgthrqiyrnlqeintfigqsvekhratldpsnprdfidv
    yllrmekdksdpssefhhqnliltvlslffagtettsttlrygfllmlkyphvtervqke
    ieqvigshrppalddrakmpytdaviheiqrlgdlipfgvphtvtkdtqfrgyvipknte
    vfpvlssalhdpryfetpntfnpghfldangalkrnegfmpfslgkriclgegiartelf
    lffttilqnfsiaspvppedidltpresgvgnvppsyqirflarh