PDB entry 1po3

View 1po3 on RCSB PDB site
Description: Crystal structure of ferric citrate transporter FecA in complex with ferric citrate
Deposited on 2003-06-13, released 2003-11-18
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-18, with a file datestamp of 2003-11-18.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.239
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1po3a_
  • Chain 'B':
    Domains in SCOP 1.67: d1po3b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1po3A (A:)
    hhhhhhhhhhaqvniapgsldkalnqyaahsgftlsvdasltrgkqsnglhgdydvesgl
    qqlldgsglqvkplgnnswtlepapapkedaltvvgdwlgdarendvfehagardvirre
    dfaktgattmrevlnripgvsapenngtgshdlamnfgirglnprlasrstvlmdgipvp
    fapygqpqlslapvslgnmdaidvvrgggavrygpqsvggvvnfvtraipqdfgieagve
    gqlsptssqnnpkethnlmvggtadngfgtallysgtrgsdwrehsatriddlmlkskya
    pdevhtfnsllqyydgeadmpgglsradydadrwqstrpydrfwgrrklaslgyqfqpds
    qhkfniqgfytqtlrsgyleqgkritlsprnywvrgieprysqifmigpsahevgvgyry
    lnesthemryytatssgqlpsgsspydrdtrsgteahawylddkidignwtitpgmrfeh
    iesyqnnaitgtheevsynaplpalnvlyhltdswnlyantegsfgtvqysqigkavqsg
    nvepekartwelgtryddgaltaemglflinfnnqydsnqtndtvtargktrhtgletqa
    rydlgtltptldnvsiyasyayvnaeirekgdtygnlvpfspkhkgtlgvdykpgnwtfn
    lnsdfqssqfadnantvkesadgstgripgfmlwgarvaydfgpqmadlnlafgvknifd
    qdyfirsyddnnkgiyagqprtlymqgslkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1po3A (A:)
    ndvfehagardvirredfaktgattmrevlnripgvsapenngtgshdlamnfgirglnp
    rlasrstvlmdgipvpfapygqpqlslapvslgnmdaidvvrgggavrygpqsvggvvnf
    vtraipqdfgieagvegqlsptssqnnpkethnlmvggtadngfgtallysgtrgsdwre
    hsatriddlmlkskyapdevhtfnsllqyydgeadmpgglsradydadrwqstrpydrfw
    grrklaslgyqfqpdsqhkfniqgfytqtlrsgyleqgkritlsprnywvrgieprysqi
    fmigpsahevgvgyrylnesthemryytatssgqlpsgsspydrdtrsgteahawylddk
    idignwtitpgmrfehiesyqnnaitgtheevsynaplpalnvlyhltdswnlyantegs
    fgtvqysqigkavqsgnvepekartwelgtryddgaltaemglflinfnnqydsnqtndt
    vtargktrhtgletqarydlgtltptldnvsiyasyayvnaeirekgdtygnlvpfspkh
    kgtlgvdykpgnwtfnlnsdfqssqfadnantvkesadgstgripgfmlwgarvaydfgp
    qmadlnlafgvknifdqdyfirsyddnnkgiyagqprtlymqgslkf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1po3B (B:)
    hhhhhhhhhhaqvniapgsldkalnqyaahsgftlsvdasltrgkqsnglhgdydvesgl
    qqlldgsglqvkplgnnswtlepapapkedaltvvgdwlgdarendvfehagardvirre
    dfaktgattmrevlnripgvsapenngtgshdlamnfgirglnprlasrstvlmdgipvp
    fapygqpqlslapvslgnmdaidvvrgggavrygpqsvggvvnfvtraipqdfgieagve
    gqlsptssqnnpkethnlmvggtadngfgtallysgtrgsdwrehsatriddlmlkskya
    pdevhtfnsllqyydgeadmpgglsradydadrwqstrpydrfwgrrklaslgyqfqpds
    qhkfniqgfytqtlrsgyleqgkritlsprnywvrgieprysqifmigpsahevgvgyry
    lnesthemryytatssgqlpsgsspydrdtrsgteahawylddkidignwtitpgmrfeh
    iesyqnnaitgtheevsynaplpalnvlyhltdswnlyantegsfgtvqysqigkavqsg
    nvepekartwelgtryddgaltaemglflinfnnqydsnqtndtvtargktrhtgletqa
    rydlgtltptldnvsiyasyayvnaeirekgdtygnlvpfspkhkgtlgvdykpgnwtfn
    lnsdfqssqfadnantvkesadgstgripgfmlwgarvaydfgpqmadlnlafgvknifd
    qdyfirsyddnnkgiyagqprtlymqgslkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1po3B (B:)
    vfehagardvirredfaktgattmrevlnripgvsapenngtgshdlamnfgirglnprl
    asrstvlmdgipvpfapygqpqlslapvslgnmdaidvvrgggavrygpqsvggvvnfvt
    raipqdfgieagvegqlsptssqnnpkethnlmvggtadngfgtallysgtrgsdwrehs
    atriddlmlkskyapdevhtfnsllqyydgeadmpgglsradydadrwqstrpydrfwgr
    rklaslgyqfqpdsqhkfniqgfytqtlrsgyleqgkritlsprnywvrgieprysqifm
    igpsahevgvgyrylnesthemryytatssgqlpsgsspydrdtrsgteahawylddkid
    ignwtitpgmrfehiesyqnnaitgtheevsynaplpalnvlyhltdswnlyantegsfg
    tvqysqigkavqsgnvepekartwelgtryddgaltaemglflinfnnqydsnqtndtvt
    argktrhtgletqarydlgtltptldnvsiyasyayvnaeirekgdtygnlvpfspkhkg
    tlgvdykpgnwtfnlnsdfqssqfadnantvkesadgstgripgfmlwgarvaydfgpqm
    adlnlafgvknifdqdyfirsyddnnkgiyagqprtlymqgslkf