PDB entry 1pnz

View 1pnz on RCSB PDB site
Description: Crystal structure of ferric citrate transporter FecA in the unliganded form
Class: membrane protein
Keywords: outer membrane protein, beta barrel, TonB-dependent transport
Deposited on 2003-06-13, released 2003-11-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.223
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron(III) dicitrate transport protein fecA precursor
    Species: Escherichia coli [TaxId:562]
    Gene: FECA OR B4291
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1pnza_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pnzA (A:)
    hhhhhhhhhhaqvniapgsldkalnqyaahsgftlsvdasltrgkqsnglhgdydvesgl
    qqlldgsglqvkplgnnswtlepapapkedaltvvgdwlgdarendvfehagardvirre
    dfaktgattmrevlnripgvsapenngtgshdlamnfgirglnprlasrstvlmdgipvp
    fapygqpqlslapvslgnmdaidvvrgggavrygpqsvggvvnfvtraipqdfgieagve
    gqlsptssqnnpkethnlmvggtadngfgtallysgtrgsdwrehsatriddlmlkskya
    pdevhtfnsllqyydgeadmpgglsradydadrwqstrpydrfwgrrklaslgyqfqpds
    qhkfniqgfytqtlrsgyleqgkritlsprnywvrgieprysqifmigpsahevgvgyry
    lnesthemryytatssgqlpsgsspydrdtrsgteahawylddkidignwtitpgmrfeh
    iesyqnnaitgtheevsynaplpalnvlyhltdswnlyantegsfgtvqysqigkavqsg
    nvepekartwelgtryddgaltaemglflinfnnqydsnqtndtvtargktrhtgletqa
    rydlgtltptldnvsiyasyayvnaeirekgdtygnlvpfspkhkgtlgvdykpgnwtfn
    lnsdfqssqfadnantvkesadgstgripgfmlwgarvaydfgpqmadlnlafgvknifd
    qdyfirsyddnnkgiyagqprtlymqgslkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pnzA (A:)
    altvvgdwlgdarendvfehagardvirredfaktgattmrevlnripgvsapenngtgs
    hdlamnfgirglnprlasrstvlmdgipvpfapygqpqlslapvslgnmdaidvvrggga
    vrygpqsvggvvnfvtraipqdfgieagvegqlsptssqnnpkethnlmvggtadngfgt
    allysgtrgsdwrehsatriddlmlkskyapdevhtfnsllqyydgeadmpgglsradyd
    adrwqstrpydrfwgrrklaslgyqfqpdsqhkfniqgfytqtlrsgyleqgkritlspr
    nywvrgieprysqifmigpsahevgvgyrylnesthemryytatssgqlpsgsspydrdt
    rsgteahawylddkidignwtitpgmrfehiesyqnnaitgtheevsynaplpalnvlyh
    ltdswnlyantegsfgtvqysqigkavqsgnvepekartwelgtryddgaltaemglfli
    nfnnqydsnqtndtvtargktrhtgletqarydlgtltptldnvsiyasyayvnaeirek
    gdtygnlvpfspkhkgtlgvdykpgnwtfnlnsdfqssqfadnantvkesadgstgripg
    fmlwgarvaydfgpqmadlnlafgvknifdqdyfirsyddnnkgiyagqprtlymqgslk
    f