PDB entry 1pny

View 1pny on RCSB PDB site
Description: Crystal Structure of the Wild Type Ribosome from E. Coli, 50S Subunit of 70S Ribosome. THIS FILE, 1PNY, CONTAINS ONLY MOLECULES OF THE 50S RIBOSOMAL SUBUNIT. THE 30S SUBUNIT IS IN THE PDB FILE 1PNX.
Class: ribosome
Keywords: 50S ribosomal subunit, PROTEIN-PROTEIN COMPLEX, RNA-RNA COMPLEX, PROTEIN-RNA COMPLEX, RIBOSOME
Deposited on 2003-06-13, released 2003-07-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 9.5 Å
R-factor: 0.389
AEROSPACI score: -0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: 23S ribosomal RNA
    Species: Escherichia coli [TaxId:562]
  • Chain '1':
    Compound: 50S ribosomal protein L33
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-52)
    Domains in SCOPe 2.04: d1pny1_
  • Chain '2':
    Compound: 50S ribosomal protein L34
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-45)
    Domains in SCOPe 2.04: d1pny2_
  • Chain '3':
    Compound: 50S ribosomal protein L35
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-62)
    Domains in SCOPe 2.04: d1pny3_
  • Chain '4':
    Compound: 50S ribosomal protein L36
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-34)
    Domains in SCOPe 2.04: d1pny4_
  • Chain '5':
    Compound: 50s ribosomal protein l1p
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-216)
    Domains in SCOPe 2.04: d1pny5_
  • Chain '9':
    Compound: 5S ribosomal RNA
    Species: Escherichia coli [TaxId:562]
  • Chain 'A':
    Compound: 50S ribosomal protein L2
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-269)
    Domains in SCOPe 2.04: d1pnya_
  • Chain 'B':
    Compound: 50S ribosomal protein L3
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-204)
    Domains in SCOPe 2.04: d1pnyb_
  • Chain 'C':
    Compound: 50S ribosomal protein L4
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-196)
    Domains in SCOPe 2.04: d1pnyc_
  • Chain 'D':
    Compound: 50S ribosomal protein L5
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-177)
    Domains in SCOPe 2.04: d1pnyd_
  • Chain 'E':
    Compound: 50S ribosomal protein L6
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-176)
    Domains in SCOPe 2.04: d1pnye_
  • Chain 'F':
    Compound: 50S ribosomal protein L9
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-51)
    Domains in SCOPe 2.04: d1pnyf_
  • Chain 'G':
    Compound: 50S ribosomal protein L11
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-142)
    Domains in SCOPe 2.04: d1pnyg_
  • Chain 'H':
    Compound: 50S ribosomal protein L13
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-142)
    Domains in SCOPe 2.04: d1pnyh_
  • Chain 'I':
    Compound: 50S ribosomal protein L14
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-131)
    Domains in SCOPe 2.04: d1pnyi_
  • Chain 'J':
    Compound: 50S ribosomal protein L15
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-140)
    Domains in SCOPe 2.04: d1pnyj_
  • Chain 'K':
    Compound: 50S ribosomal protein L16
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-123)
    Domains in SCOPe 2.04: d1pnyk_
  • Chain 'L':
    Compound: 50S ribosomal protein L17
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-113)
    Domains in SCOPe 2.04: d1pnyl_
  • Chain 'M':
    Compound: 50S ribosomal protein L18
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-110)
    Domains in SCOPe 2.04: d1pnym_
  • Chain 'N':
    Compound: 50S ribosomal protein L19
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-124)
    Domains in SCOPe 2.04: d1pnyn_
  • Chain 'O':
    Compound: 50S ribosomal protein L20
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-116)
    Domains in SCOPe 2.04: d1pnyo_
  • Chain 'P':
    Compound: 50S ribosomal protein L21
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-99)
    Domains in SCOPe 2.04: d1pnyp_
  • Chain 'Q':
    Compound: 50S ribosomal protein L22
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-129)
    Domains in SCOPe 2.04: d1pnyq_
  • Chain 'R':
    Compound: 50S ribosomal protein L23
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-92)
    Domains in SCOPe 2.04: d1pnyr_
  • Chain 'S':
    Compound: 50S ribosomal protein L24
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-112)
    Domains in SCOPe 2.04: d1pnys_
  • Chain 'T':
    Compound: general stress protein ctc
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-172)
    Domains in SCOPe 2.04: d1pnyt_
  • Chain 'U':
    Compound: 50S ribosomal protein L27
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-85)
    Domains in SCOPe 2.04: d1pnyu_
  • Chain 'V':
    Compound: 50S ribosomal protein L28
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-15)
    Domains in SCOPe 2.04: d1pnyv_
  • Chain 'W':
    Compound: 50S ribosomal protein L29
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-64)
    Domains in SCOPe 2.04: d1pnyw_
  • Chain 'X':
    Compound: 50S ribosomal protein L30
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-54)
    Domains in SCOPe 2.04: d1pnyx_
  • Chain 'Y':
    Compound: 50S ribosomal protein L31
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-72)
    Domains in SCOPe 2.04: d1pnyy_
  • Chain 'Z':
    Compound: 50S ribosomal protein L32
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNY (0-57)
    Domains in SCOPe 2.04: d1pnyz_

PDB Chain Sequences:

  • Chain '0':
    No sequence available.

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pny1 (1:)
    akdgpriivkmessagtgfyytttknrrntqaklelkkydpvakkhvvfrekk
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pny2 (2:)
    mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pny3 (3:)
    pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
    lpr
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pny4 (4:)
    kvrssvkkmcdnckvvrrhgrvlvicsnvkhkqrq
    

  • Chain '5':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pny5 (5:)
    mladkesliealklalsteynvkrnftqsveiiltfkgidmkkgdlklreivplpkqpsk
    akrvlvvpsseqleyakkaspkvvitreelqklqgqkrpvkklarqnewflinqesmala
    grilgpalgprgkfptplpntadiseyinrfkrsvlvktkdqpqvqvfigtedmkpedla
    enaiavlnaienkakvetnlrniyvkttmgkavkvkr
    

  • Chain '9':
    No sequence available.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnyA (A:)
    kkyrpytpsrrqmttadfsgltkkrpekaltealpktggrnnrgritsrfiggghkrlyr
    iidfkrrdksgvnakvaaieydpnrsariallhyadgekryilapegltvgatvnagpea
    epklgnalplrfvpvgavvhalelvpgkgaqlarsagtsvqvqgkesdyvivrlpsgelr
    rvhsecyatigavgnaehknivlgkagrsrwlgrkphqrgsamnpvdhphgggegrtgag
    rvpvtpwgkptkglktrrkrktsdrfivtr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnyB (B:)
    mkgilgtkigmtqiwkndraipvtvvlagpcpivqrktaqtdgyeavqigyapkaerkvn
    kpmqghfakagvaptrilrefrgfapdgdsvnvdifaegekidatgtskgkgtqgvmkrw
    nfaggpashgskkwhrrpgsigqrktpgrvykgkrmaghmgmervtvqnlevveiragen
    lilvkgaipgangglvvlrsaakas
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnyC (C:)
    aqinvigqnggrtielplpevnsgvlhevvtwqlasrrrgtastrtraqvsktgrkmygq
    kgtgnarhgdrsvptfvgggvafgpkprsydytlprqvrqlglamaiasrqeggklvavd
    gfdiadaktknfiswakqngldgtekvllvtddentrraarnvswvsvlpvagvnvydil
    rhdrlvidaaaleivee
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnyD (D:)
    qqlktkyndqvrpalmqqfgyssvmavpriekivvneglgsskedskaidkaakelalit
    lqkpiitkakksisnfklrqgmpvgikvtlrgermyvflekliniglprirdfrginpna
    fdgrgnynlgikeqlifpeitydmvdktrgmditivttaktdeearallqsmglpfrk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnyE (E:)
    gkqpiavpsgvtvnaqdgvfkvkgpkgeltvpynteltvrqdgdqllverpsdaqkhral
    hgltrtlvanavkgvsdgytinlelrgvgfrakltgkalemnigyshpviieppagvtfa
    vpeptridvsgidkqlvgqvaanvrkvrkpdayhgkgvrfvgeqialkagkagatgg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnyF (F:)
    mqvillepsrlgktgevvsvkdgyarnwlipqglavsatrtnmktleaqlrs
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnyG (G:)
    mkkvagivklqlpagkatpappvgpalgqyganimeftkafnaqtadkgdaiipveitiy
    adrsftfitktppmsylirkaagigkgsstpnkakvgklnwdqvleiaktkmpdlnagsv
    eaaantvagtarsmgvtveggpn
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnyH (H:)
    vktyipkndeqnwvvvdasgvplgrlatliasrirgkhrpdftpnmiqgdfvvvinaaqv
    altgkklddkvytrytgyqgglktetarealskhperviehavfgmlpkgrqgramhtrl
    kvyagethphsaqkpqvlktqpl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnyI (I:)
    impqsrldvadnsgareimcirvlnsgiggkglttggggnkryahvgdiivasvkdaapr
    gavkagdvvkavvvrtshaikradgstirfdrnaaviinnqgeprgtrvfgpvarelrdr
    rfmkivslapev
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnyJ (J:)
    hdlkptpgsrkdrkrvgrgpggtdktagrghkgqksrsgagkgaffeggrsrliarlpkr
    gfnnvgttyevvklsqlqdledttfdrdtleayrlvrrknrpvkllasgeisravtvhvd
    aasaaaikaveaaggrvvlpe
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnyK (K:)
    tkfrkqfrgrmtgdakggdyvafgdygliamepawiksnqieacrivmsrhfrrggkiyi
    rifpdkpvtkkpaetrmgkgkgaveywvsvvkpgrvmfevagvteeqakeafrlaghklp
    iqtk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnyL (L:)
    hgkagrklnrnssarvalaraqatallregriqttltkakelrpfveqlittakggdlhs
    rrlvaqdihdkdvvrkvmdevapkyaerpggytrilrvgtrrgdgvtmalielv
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnyM (M:)
    attirrklrtrrkvrtttaasgrlrlsvyrsskhiyaqiiddsrgqtlaaassaalksgn
    ktdtaaavgkalaaaaaekgikqvvfdrgsykyhgrvkaladaareggldf
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnyN (N:)
    qthikinrgellrgieqdhtrqlpdfrpgdtvrvdtkvregnrtrsqafegvviaingsg
    srksftvrkisfgegvervfpfasplvnqvtivergkvrraklyylrelrgkaariksdr
    srvmk
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnyO (O:)
    praktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrlw
    iqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrnarq
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnyP (P:)
    mfaiiqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaev
    vehgrgkkiyirkyksgvqyrrrtghrqnftaikilgiqg
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnyQ (Q:)
    eqtfrnkkqrkqqvklrkpgfavakyvrmsprkvrlvvdvirgksvqdaedllrfiprsa
    sepvakvlnsakanalhndemledrlfvkeayvdagptlkrliprargsaniikkrtshi
    tiivaekgnk
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnyR (R:)
    shydilqapvisekaysamergvysfwvspkatkteikdaiqqafgvrvigistmnvpgk
    rkrvgrfigqrndrkkaivrlaegqsiealagq
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnyS (S:)
    prpsagshhndklhfkkgdtvivlsgkhkgqtgkvllalprdqkvvvegvnvitknvkps
    mtnpqggqeqrelalhaskvalvdpetgkatrvrkqivdgkkvrvavasgkti
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnyT (T:)
    meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
    tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
    qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlp
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnyU (U:)
    ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa
    lsdgkvvfinkgkgarfisieaaqte
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnyV (V:)
    xxxxxxxxxxxxxxxx
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnyW (W:)
    kpsemrnlqatdfakeidarkkelmelrfqaaagqlaqphrvrqlrrevaqlntvkaela
    rkgeq
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnyX (X:)
    mkiklvrsvigrpgnqvktvqalglrkigdsrevsdtpavrgmvktvkhllevqe
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnyY (Y:)
    mqkdlhpkavpckiiyqgqvvmetmstrpeihvdvwsgvhpfwtgeerfldtegrvdkfn
    krfgdsyrrgskk
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnyZ (Z:)
    akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla