PDB entry 1pnv

View 1pnv on RCSB PDB site
Description: crystal structure of tdp-epi-vancosaminyltransferase gtfa in complexes with tdp and vancomycin
Deposited on 2003-06-13, released 2003-08-12
The last revision prior to the SCOP 1.69 freeze date was dated 2003-08-12, with a file datestamp of 2003-08-12.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.221
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1pnva_
  • Chain 'B':
    Domains in SCOP 1.69: d1pnvb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pnvA (A:)
    mrvlitgcgsrgdteplvalaarlrelgadarmclppdyvercaevgvpmvpvgravrag
    arepgelppgaaevvtevvaewfdkvpaaiegcdavvttgllpaavavrsmaeklgipyr
    ytvlspdhlpseqsqaerdmynqgadrlfgdavnshrasiglppvehlydygytdqpwla
    adpvlsplrptdlgtvqtgawilpderplsaeleaflaagstpvyvgfgsssrpatadaa
    kmaikavrasgrrivlsrgwadlvlpddgadcfvvgevnlqelfgrvaaaihhdsagttl
    lamragipqivvrrvvdnvveqayhadrvaelgvgvavdgpvptidslsaaldtalapei
    rarattvadtiradgttvaaqllfdavslekptvpalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pnvA (A:)
    mrvlitgcgsrgdteplvalaarlrelgadarmclppdyvercaevgvpmvpvgravrag
    arepgelppgaaevvtevvaewfdkvpaaiegcdavvttgllpaavavrsmaeklgipyr
    ytvlspdhlpseqsqaerdmynqgadrlfgdavnshrasiglppvehlydygytdqpwla
    adpvlsplrptdlgtvqtgawilpderplsaeleaflaagstpvyvgfgsssrpatadaa
    kmaikavrasgrrivlsrgwadlvlpddgadcfvvgevnlqelfgrvaaaihhdsagttl
    lamragipqivvrrvyhadrvaelgvgvavdgpvptidslsaaldtalapeirarattva
    dtiradgttvaaqllfdavsle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pnvB (B:)
    mrvlitgcgsrgdteplvalaarlrelgadarmclppdyvercaevgvpmvpvgravrag
    arepgelppgaaevvtevvaewfdkvpaaiegcdavvttgllpaavavrsmaeklgipyr
    ytvlspdhlpseqsqaerdmynqgadrlfgdavnshrasiglppvehlydygytdqpwla
    adpvlsplrptdlgtvqtgawilpderplsaeleaflaagstpvyvgfgsssrpatadaa
    kmaikavrasgrrivlsrgwadlvlpddgadcfvvgevnlqelfgrvaaaihhdsagttl
    lamragipqivvrrvvdnvveqayhadrvaelgvgvavdgpvptidslsaaldtalapei
    rarattvadtiradgttvaaqllfdavslekptvpalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pnvB (B:)
    mrvlitgcgsrgdteplvalaarlrelgadarmclppdyvercaevgvpmvpvgravrag
    arepgelppgaaevvtevvaewfdkvpaaiegcdavvttgllpaavavrsmaeklgipyr
    ytvlspdhlpseqsqaerdmynqgadrlfgdavnshrasiglppvehlydygytdqpwla
    adpvlsplrptdlgtvqtgawilpderplsaeleaflaagstpvyvgfgsssrpatadaa
    kmaikavrasgrrivlsrgwadlvlpddgadcfvvgevnlqelfgrvaaaihhdsagttl
    lamragipqivvrrvayhadrvaelgvgvavdgpvptidslsaaldtalapeirarattv
    adtiradgttvaaqllfdavslek