PDB entry 1pnu

View 1pnu on RCSB PDB site
Description: crystal structure of a streptomycin dependent ribosome from escherichia coli, 50s subunit of 70s ribosome. this file, 1pnu, contains only molecules of the 50s ribosomal subunit. the 30s subunit, mrna, p-site trna, and a-site trna are in the pdb file 1pns.
Deposited on 2003-06-13, released 2003-07-15
The last revision prior to the SCOP 1.71 freeze date was dated 2004-04-06, with a file datestamp of 2004-04-06.
Experiment type: XRAY
Resolution: 8.7 Å
R-factor: 0.394
AEROSPACI score: -0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Domains in SCOP 1.71: d1pnu0_
  • Chain '1':
    Domains in SCOP 1.71: d1pnu1_
  • Chain '2':
    Domains in SCOP 1.71: d1pnu2_
  • Chain '3':
    Domains in SCOP 1.71: d1pnu3_
  • Chain '4':
    Domains in SCOP 1.71: d1pnu4_
  • Chain '5':
    Domains in SCOP 1.71: d1pnu5_
  • Chain '9':
    Domains in SCOP 1.71: d1pnu9_
  • Chain 'A':
    Domains in SCOP 1.71: d1pnua_
  • Chain 'B':
    Domains in SCOP 1.71: d1pnub_
  • Chain 'C':
    Domains in SCOP 1.71: d1pnuc_
  • Chain 'D':
    Domains in SCOP 1.71: d1pnud_
  • Chain 'E':
    Domains in SCOP 1.71: d1pnue_
  • Chain 'F':
    Domains in SCOP 1.71: d1pnuf_
  • Chain 'G':
    Domains in SCOP 1.71: d1pnug_
  • Chain 'H':
    Domains in SCOP 1.71: d1pnuh_
  • Chain 'I':
    Domains in SCOP 1.71: d1pnui_
  • Chain 'J':
    Domains in SCOP 1.71: d1pnuj_
  • Chain 'K':
    Domains in SCOP 1.71: d1pnuk_
  • Chain 'L':
    Domains in SCOP 1.71: d1pnul_
  • Chain 'M':
    Domains in SCOP 1.71: d1pnum_
  • Chain 'N':
    Domains in SCOP 1.71: d1pnun_
  • Chain 'O':
    Domains in SCOP 1.71: d1pnuo_
  • Chain 'P':
    Domains in SCOP 1.71: d1pnup_
  • Chain 'Q':
    Domains in SCOP 1.71: d1pnuq_
  • Chain 'R':
    Domains in SCOP 1.71: d1pnur_
  • Chain 'S':
    Domains in SCOP 1.71: d1pnus_
  • Chain 'T':
    Domains in SCOP 1.71: d1pnut_
  • Chain 'U':
    Domains in SCOP 1.71: d1pnuu_
  • Chain 'V':
    Domains in SCOP 1.71: d1pnuv_
  • Chain 'W':
    Domains in SCOP 1.71: d1pnuw_
  • Chain 'X':
    Domains in SCOP 1.71: d1pnux_
  • Chain 'Y':
    Domains in SCOP 1.71: d1pnuy_
  • Chain 'Z':
    Domains in SCOP 1.71: d1pnuz_

PDB Chain Sequences:

  • Chain '0':
    No sequence available.

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnu1 (1:)
    akdgpriivkmessagtgfyytttknrrntqaklelkkydpvakkhvvfrekk
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnu2 (2:)
    mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnu3 (3:)
    pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
    lpr
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnu4 (4:)
    kvrssvkkmcdnckvvrrhgrvlvicsnvkhkqrq
    

  • Chain '5':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnu5 (5:)
    mladkesliealklalsteynvkrnftqsveiiltfkgidmkkgdlklreivplpkqpsk
    akrvlvvpsseqleyakkaspkvvitreelqklqgqkrpvkklarqnewflinqesmala
    grilgpalgprgkfptplpntadiseyinrfkrsvlvktkdqpqvqvfigtedmkpedla
    enaiavlnaienkakvetnlrniyvkttmgkavkvkr
    

  • Chain '9':
    No sequence available.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuA (A:)
    kkyrpytpsrrqmttadfsgltkkrpekaltealpktggrnnrgritsrfiggghkrlyr
    iidfkrrdksgvnakvaaieydpnrsariallhyadgekryilapegltvgatvnagpea
    epklgnalplrfvpvgavvhalelvpgkgaqlarsagtsvqvqgkesdyvivrlpsgelr
    rvhsecyatigavgnaehknivlgkagrsrwlgrkphqrgsamnpvdhphgggegrtgag
    rvpvtpwgkptkglktrrkrktsdrfivtr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuB (B:)
    mkgilgtkigmtqiwkndraipvtvvlagpcpivqrktaqtdgyeavqigyapkaerkvn
    kpmqghfakagvaptrilrefrgfapdgdsvnvdifaegekidatgtskgkgtqgvmkrw
    nfaggpashgskkwhrrpgsigqrktpgrvykgkrmaghmgmervtvqnlevveiragen
    lilvkgaipgangglvvlrsaakas
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuC (C:)
    aqinvigqnggrtielplpevnsgvlhevvtwqlasrrrgtastrtraqvsktgrkmygq
    kgtgnarhgdrsvptfvgggvafgpkprsydytlprqvrqlglamaiasrqeggklvavd
    gfdiadaktknfiswakqngldgtekvllvtddentrraarnvswvsvlpvagvnvydil
    rhdrlvidaaaleivee
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuD (D:)
    qqlktkyndqvrpalmqqfgyssvmavpriekivvneglgsskedskaidkaakelalit
    lqkpiitkakksisnfklrqgmpvgikvtlrgermyvflekliniglprirdfrginpna
    fdgrgnynlgikeqlifpeitydmvdktrgmditivttaktdeearallqsmglpfrk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuE (E:)
    gkqpiavpsgvtvnaqdgvfkvkgpkgeltvpynteltvrqdgdqllverpsdaqkhral
    hgltrtlvanavkgvsdgytinlelrgvgfrakltgkalemnigyshpviieppagvtfa
    vpeptridvsgidkqlvgqvaanvrkvrkpdayhgkgvrfvgeqialkagkagatgg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuF (F:)
    mqvillepsrlgktgevvsvkdgyarnwlipqglavsatrtnmktleaqlrs
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuG (G:)
    mkkvagivklqlpagkatpappvgpalgqyganimeftkafnaqtadkgdaiipveitiy
    adrsftfitktppmsylirkaagigkgsstpnkakvgklnwdqvleiaktkmpdlnagsv
    eaaantvagtarsmgvtveggpn
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuH (H:)
    vktyipkndeqnwvvvdasgvplgrlatliasrirgkhrpdftpnmiqgdfvvvinaaqv
    altgkklddkvytrytgyqgglktetarealskhperviehavfgmlpkgrqgramhtrl
    kvyagethphsaqkpqvlktqpl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuI (I:)
    impqsrldvadnsgareimcirvlnsgiggkglttggggnkryahvgdiivasvkdaapr
    gavkagdvvkavvvrtshaikradgstirfdrnaaviinnqgeprgtrvfgpvarelrdr
    rfmkivslapev
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuJ (J:)
    hdlkptpgsrkdrkrvgrgpggtdktagrghkgqksrsgagkgaffeggrsrliarlpkr
    gfnnvgttyevvklsqlqdledttfdrdtleayrlvrrknrpvkllasgeisravtvhvd
    aasaaaikaveaaggrvvlpe
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuK (K:)
    tkfrkqfrgrmtgdakggdyvafgdygliamepawiksnqieacrivmsrhfrrggkiyi
    rifpdkpvtkkpaetrmgkgkgaveywvsvvkpgrvmfevagvteeqakeafrlaghklp
    iqtk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuL (L:)
    hgkagrklnrnssarvalaraqatallregriqttltkakelrpfveqlittakggdlhs
    rrlvaqdihdkdvvrkvmdevapkyaerpggytrilrvgtrrgdgvtmalielv
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuM (M:)
    attirrklrtrrkvrtttaasgrlrlsvyrsskhiyaqiiddsrgqtlaaassaalksgn
    ktdtaaavgkalaaaaaekgikqvvfdrgsykyhgrvkaladaareggldf
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuN (N:)
    qthikinrgellrgieqdhtrqlpdfrpgdtvrvdtkvregnrtrsqafegvviaingsg
    srksftvrkisfgegvervfpfasplvnqvtivergkvrraklyylrelrgkaariksdr
    srvmk
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuO (O:)
    praktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrlw
    iqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrnarq
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuP (P:)
    mfaiiqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaev
    vehgrgkkiyirkyksgvqyrrrtghrqnftaikilgiqg
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuQ (Q:)
    eqtfrnkkqrkqqvklrkpgfavakyvrmsprkvrlvvdvirgksvqdaedllrfiprsa
    sepvakvlnsakanalhndemledrlfvkeayvdagptlkrliprargsaniikkrtshi
    tiivaekgnk
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuR (R:)
    shydilqapvisekaysamergvysfwvspkatkteikdaiqqafgvrvigistmnvpgk
    rkrvgrfigqrndrkkaivrlaegqsiealagq
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuS (S:)
    prpsagshhndklhfkkgdtvivlsgkhkgqtgkvllalprdqkvvvegvnvitknvkps
    mtnpqggqeqrelalhaskvalvdpetgkatrvrkqivdgkkvrvavasgkti
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuT (T:)
    meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
    tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
    qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlp
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuU (U:)
    ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa
    lsdgkvvfinkgkgarfisieaaqte
    

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuW (W:)
    kpsemrnlqatdfakeidarkkelmelrfqaaagqlaqphrvrqlrrevaqlntvkaela
    rkgeq
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuX (X:)
    mkiklvrsvigrpgnqvktvqalglrkigdsrevsdtpavrgmvktvkhllevqe
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuY (Y:)
    mqkdlhpkavpckiiyqgqvvmetmstrpeihvdvwsgvhpfwtgeerfldtegrvdkfn
    krfgdsyrrgskk
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuZ (Z:)
    akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla