PDB entry 1pnu

View 1pnu on RCSB PDB site
Description: Crystal Structure of a Streptomycin Dependent Ribosome from Escherichia Coli, 50S Subunit of 70S Ribosome. THIS FILE, 1PNU, CONTAINS ONLY MOLECULES OF THE 50S RIBOSOMAL SUBUNIT. THE 30S SUBUNIT, MRNA, P-SITE TRNA, AND A-SITE TRNA ARE IN THE PDB FILE 1PNS.
Class: ribosome
Keywords: 50S Ribosomal Subunit, PROTEIN-PROTEIN COMPLEX, RNA-RNA COMPLEX, PROTEIN-RNA COMPLEX, RIBOSOME
Deposited on 2003-06-13, released 2003-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 8.7 Å
R-factor: 0.394
AEROSPACI score: -0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: 23S ribosomal RNA
    Species: Escherichia coli [TaxId:562]
  • Chain '1':
    Compound: 50S ribosomal protein L33
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-52)
    Domains in SCOPe 2.07: d1pnu1_
  • Chain '2':
    Compound: 50S ribosomal protein L34
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-45)
    Domains in SCOPe 2.07: d1pnu2_
  • Chain '3':
    Compound: 50S ribosomal protein L35
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-62)
    Domains in SCOPe 2.07: d1pnu3_
  • Chain '4':
    Compound: 50S ribosomal protein L36
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-34)
    Domains in SCOPe 2.07: d1pnu4_
  • Chain '5':
    Compound: 50s ribosomal protein l1p
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-216)
    Domains in SCOPe 2.07: d1pnu51, d1pnu52
  • Chain '9':
    Compound: 5S ribosomal RNA
    Species: Escherichia coli [TaxId:562]
  • Chain 'A':
    Compound: 50S ribosomal protein L2
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-269)
    Domains in SCOPe 2.07: d1pnua_
  • Chain 'B':
    Compound: 50S ribosomal protein L3
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-204)
    Domains in SCOPe 2.07: d1pnub_
  • Chain 'C':
    Compound: 50S ribosomal protein L4
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-196)
    Domains in SCOPe 2.07: d1pnuc_
  • Chain 'D':
    Compound: 50S ribosomal protein L5
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-177)
    Domains in SCOPe 2.07: d1pnud_
  • Chain 'E':
    Compound: 50S ribosomal protein L6
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-176)
    Domains in SCOPe 2.07: d1pnue_
  • Chain 'F':
    Compound: 50S ribosomal protein L9
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-51)
    Domains in SCOPe 2.07: d1pnuf_
  • Chain 'G':
    Compound: 50S ribosomal protein L11
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-142)
    Domains in SCOPe 2.07: d1pnug_
  • Chain 'H':
    Compound: 50S ribosomal protein L13
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-142)
    Domains in SCOPe 2.07: d1pnuh_
  • Chain 'I':
    Compound: 50S ribosomal protein L14
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-131)
    Domains in SCOPe 2.07: d1pnui_
  • Chain 'J':
    Compound: 50S ribosomal protein L15
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-140)
    Domains in SCOPe 2.07: d1pnuj_
  • Chain 'K':
    Compound: 50S ribosomal protein L16
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-123)
    Domains in SCOPe 2.07: d1pnuk_
  • Chain 'L':
    Compound: 50S ribosomal protein L17
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-113)
    Domains in SCOPe 2.07: d1pnul_
  • Chain 'M':
    Compound: 50S ribosomal protein L18
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-110)
    Domains in SCOPe 2.07: d1pnum_
  • Chain 'N':
    Compound: 50S ribosomal protein L19
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-124)
    Domains in SCOPe 2.07: d1pnun_
  • Chain 'O':
    Compound: 50S ribosomal protein L20
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-116)
    Domains in SCOPe 2.07: d1pnuo_
  • Chain 'P':
    Compound: 50S ribosomal protein L21
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-99)
    Domains in SCOPe 2.07: d1pnup_
  • Chain 'Q':
    Compound: 50S ribosomal protein L22
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-129)
    Domains in SCOPe 2.07: d1pnuq_
  • Chain 'R':
    Compound: 50S ribosomal protein L23
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-92)
    Domains in SCOPe 2.07: d1pnur_
  • Chain 'S':
    Compound: 50S ribosomal protein L24
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-112)
    Domains in SCOPe 2.07: d1pnus_
  • Chain 'T':
    Compound: general stress protein ctc
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-172)
    Domains in SCOPe 2.07: d1pnut_
  • Chain 'U':
    Compound: 50S ribosomal protein L27
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-85)
    Domains in SCOPe 2.07: d1pnuu_
  • Chain 'V':
    Compound: 50S ribosomal protein L28
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-15)
    Domains in SCOPe 2.07: d1pnuv_
  • Chain 'W':
    Compound: 50S ribosomal protein L29
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-64)
    Domains in SCOPe 2.07: d1pnuw_
  • Chain 'X':
    Compound: 50S ribosomal protein L30
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-54)
    Domains in SCOPe 2.07: d1pnux_
  • Chain 'Y':
    Compound: 50S ribosomal protein L31
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-72)
    Domains in SCOPe 2.07: d1pnuy_
  • Chain 'Z':
    Compound: 50S ribosomal protein L32
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1PNU (0-57)
    Domains in SCOPe 2.07: d1pnuz_

PDB Chain Sequences:

  • Chain '0':
    No sequence available.

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnu1 (1:)
    akdgpriivkmessagtgfyytttknrrntqaklelkkydpvakkhvvfrekk
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnu2 (2:)
    mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnu3 (3:)
    pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
    lpr
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnu4 (4:)
    kvrssvkkmcdnckvvrrhgrvlvicsnvkhkqrq
    

  • Chain '5':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnu5 (5:)
    mladkesliealklalsteynvkrnftqsveiiltfkgidmkkgdlklreivplpkqpsk
    akrvlvvpsseqleyakkaspkvvitreelqklqgqkrpvkklarqnewflinqesmala
    grilgpalgprgkfptplpntadiseyinrfkrsvlvktkdqpqvqvfigtedmkpedla
    enaiavlnaienkakvetnlrniyvkttmgkavkvkr
    

  • Chain '9':
    No sequence available.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuA (A:)
    kkyrpytpsrrqmttadfsgltkkrpekaltealpktggrnnrgritsrfiggghkrlyr
    iidfkrrdksgvnakvaaieydpnrsariallhyadgekryilapegltvgatvnagpea
    epklgnalplrfvpvgavvhalelvpgkgaqlarsagtsvqvqgkesdyvivrlpsgelr
    rvhsecyatigavgnaehknivlgkagrsrwlgrkphqrgsamnpvdhphgggegrtgag
    rvpvtpwgkptkglktrrkrktsdrfivtr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuB (B:)
    mkgilgtkigmtqiwkndraipvtvvlagpcpivqrktaqtdgyeavqigyapkaerkvn
    kpmqghfakagvaptrilrefrgfapdgdsvnvdifaegekidatgtskgkgtqgvmkrw
    nfaggpashgskkwhrrpgsigqrktpgrvykgkrmaghmgmervtvqnlevveiragen
    lilvkgaipgangglvvlrsaakas
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuC (C:)
    aqinvigqnggrtielplpevnsgvlhevvtwqlasrrrgtastrtraqvsktgrkmygq
    kgtgnarhgdrsvptfvgggvafgpkprsydytlprqvrqlglamaiasrqeggklvavd
    gfdiadaktknfiswakqngldgtekvllvtddentrraarnvswvsvlpvagvnvydil
    rhdrlvidaaaleivee
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuD (D:)
    qqlktkyndqvrpalmqqfgyssvmavpriekivvneglgsskedskaidkaakelalit
    lqkpiitkakksisnfklrqgmpvgikvtlrgermyvflekliniglprirdfrginpna
    fdgrgnynlgikeqlifpeitydmvdktrgmditivttaktdeearallqsmglpfrk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuE (E:)
    gkqpiavpsgvtvnaqdgvfkvkgpkgeltvpynteltvrqdgdqllverpsdaqkhral
    hgltrtlvanavkgvsdgytinlelrgvgfrakltgkalemnigyshpviieppagvtfa
    vpeptridvsgidkqlvgqvaanvrkvrkpdayhgkgvrfvgeqialkagkagatgg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuF (F:)
    mqvillepsrlgktgevvsvkdgyarnwlipqglavsatrtnmktleaqlrs
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuG (G:)
    mkkvagivklqlpagkatpappvgpalgqyganimeftkafnaqtadkgdaiipveitiy
    adrsftfitktppmsylirkaagigkgsstpnkakvgklnwdqvleiaktkmpdlnagsv
    eaaantvagtarsmgvtveggpn
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuH (H:)
    vktyipkndeqnwvvvdasgvplgrlatliasrirgkhrpdftpnmiqgdfvvvinaaqv
    altgkklddkvytrytgyqgglktetarealskhperviehavfgmlpkgrqgramhtrl
    kvyagethphsaqkpqvlktqpl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuI (I:)
    impqsrldvadnsgareimcirvlnsgiggkglttggggnkryahvgdiivasvkdaapr
    gavkagdvvkavvvrtshaikradgstirfdrnaaviinnqgeprgtrvfgpvarelrdr
    rfmkivslapev
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuJ (J:)
    hdlkptpgsrkdrkrvgrgpggtdktagrghkgqksrsgagkgaffeggrsrliarlpkr
    gfnnvgttyevvklsqlqdledttfdrdtleayrlvrrknrpvkllasgeisravtvhvd
    aasaaaikaveaaggrvvlpe
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuK (K:)
    tkfrkqfrgrmtgdakggdyvafgdygliamepawiksnqieacrivmsrhfrrggkiyi
    rifpdkpvtkkpaetrmgkgkgaveywvsvvkpgrvmfevagvteeqakeafrlaghklp
    iqtk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuL (L:)
    hgkagrklnrnssarvalaraqatallregriqttltkakelrpfveqlittakggdlhs
    rrlvaqdihdkdvvrkvmdevapkyaerpggytrilrvgtrrgdgvtmalielv
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuM (M:)
    attirrklrtrrkvrtttaasgrlrlsvyrsskhiyaqiiddsrgqtlaaassaalksgn
    ktdtaaavgkalaaaaaekgikqvvfdrgsykyhgrvkaladaareggldf
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuN (N:)
    qthikinrgellrgieqdhtrqlpdfrpgdtvrvdtkvregnrtrsqafegvviaingsg
    srksftvrkisfgegvervfpfasplvnqvtivergkvrraklyylrelrgkaariksdr
    srvmk
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuO (O:)
    praktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrlw
    iqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrnarq
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuP (P:)
    mfaiiqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaev
    vehgrgkkiyirkyksgvqyrrrtghrqnftaikilgiqg
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuQ (Q:)
    eqtfrnkkqrkqqvklrkpgfavakyvrmsprkvrlvvdvirgksvqdaedllrfiprsa
    sepvakvlnsakanalhndemledrlfvkeayvdagptlkrliprargsaniikkrtshi
    tiivaekgnk
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuR (R:)
    shydilqapvisekaysamergvysfwvspkatkteikdaiqqafgvrvigistmnvpgk
    rkrvgrfigqrndrkkaivrlaegqsiealagq
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuS (S:)
    prpsagshhndklhfkkgdtvivlsgkhkgqtgkvllalprdqkvvvegvnvitknvkps
    mtnpqggqeqrelalhaskvalvdpetgkatrvrkqivdgkkvrvavasgkti
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuT (T:)
    meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
    tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
    qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlp
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuU (U:)
    ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa
    lsdgkvvfinkgkgarfisieaaqte
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuV (V:)
    xxxxxxxxxxxxxxxx
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuW (W:)
    kpsemrnlqatdfakeidarkkelmelrfqaaagqlaqphrvrqlrrevaqlntvkaela
    rkgeq
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuX (X:)
    mkiklvrsvigrpgnqvktvqalglrkigdsrevsdtpavrgmvktvkhllevqe
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuY (Y:)
    mqkdlhpkavpckiiyqgqvvmetmstrpeihvdvwsgvhpfwtgeerfldtegrvdkfn
    krfgdsyrrgskk
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pnuZ (Z:)
    akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla