PDB entry 1pnt

View 1pnt on RCSB PDB site
Description: crystal structure of bovine heart phosphotyrosyl phosphatase at 2.2 angstroms resolution
Class: hydrolase
Keywords: hydrolase
Deposited on 1994-08-05, released 1995-02-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.166
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: acid phosphatase
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11064 (0-156)
  Domains in SCOPe 2.01: d1pnta_
• Heterogens: PO4

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pntA (A:)
  aeqvtksvlfvclgnicrspiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdprav
  sclrnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsyd
  pqkqliiedpyygndadfetvyqqcvrccraflekvr