PDB entry 1pnt

View 1pnt on RCSB PDB site
Description: crystal structure of bovine heart phosphotyrosyl phosphatase at 2.2 angstroms resolution
Deposited on 1994-08-05, released 1995-02-07
The last revision prior to the SCOP 1.57 freeze date was dated 1995-02-07, with a file datestamp of 1995-02-14.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.166
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1pnt__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1pnt_ (-)
aeqvtksvlfvclgnicrspiaeavfrklvtdqnisdnwvidsgavsdwnvgrspdprav
sclrnhgintahkarqvtkedfvtfdyilcmdesnlrdlnrksnqvkncrakiellgsyd
pqkqliiedpyygndadfetvyqqcvrccraflekvr